Cat#:FPA-31807P;Product Name:Rabbit Anti-PFDN1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human PFDN1 aa 1-50 (N terminal). Sequence: MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTE ;Species Reactivity:Mouse, Human Predicted to work with: Cow, Orangutan;Isotype:IgG;Application:IHC-P, WB;Storage Buffer:pH: 7.4 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 50% Glycerol, 0.87% Sodium chloride PBS (without Mg2+, Ca2+);Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;