Cat#:FPA-31795P;Product Name:Rabbit Anti-PFAS Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human PFAS aa 925-975 (internal sequence). The exact sequence is proprietary. NP_036525.1 Sequence: AGNCGLQVDVPVPRVDVLSVLFAEEPGLVLEVQEPDLAQVLKRYRDAGLH C ;Species Reactivity:Human Predicted to work with: Chimpanzee, Rhesus monkey, Gorilla, Orangutan;Isotype:IgG;Application:WB;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7-8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human PFAS aa 925-975 (internal sequence). The exact sequence is proprietary. NP_036525.1 Sequence: AGNCGLQVDVPVPRVDVLSVLFAEEPGLVLEVQEPDLAQVLKRYRDAGLH C
Species Reactivity:
Human Predicted to work with: Chimpanzee, Rhesus monkey, Gorilla, Orangutan
Isotype:
IgG
Application:
WB
Storage Buffer:
Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7-8
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.