Cat#:FPA-31761P;Product Name:Rabbit Anti-PEX13 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human PEX13 aa 342-403. The exact sequence is proprietary. NP_002609.1 Sequence: TVESSKVSKQQQSFTNPTLTKGATVADSDEQEAAFESVFVETNKVPVAPD SIGKDGEKQDL ;Species Reactivity:Human;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:pH: 7 Preservative: 0.01% Thimerosal (merthiolate) Constituents: 89% PBS, 10% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human PEX13 aa 342-403. The exact sequence is proprietary. NP_002609.1 Sequence: TVESSKVSKQQQSFTNPTLTKGATVADSDEQEAAFESVFVETNKVPVAPD SIGKDGEKQDL