Cat#:FPA-31759P;Product Name:Rabbit Anti-PEX11C Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human PEX11C aa 1-46 (N terminal). The exact sequence is proprietary. Sequence: MASLSGLASALESYRGRDRLIRVLGYCCQLVGGVLVEQCPARSEVG ;Species Reactivity:Mouse, Rat, Human;Isotype:IgG;Application:WB;Storage Buffer:pH: 7.3 Preservative: 0.05% Sodium azide Constituent: 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human PEX11C aa 1-46 (N terminal). The exact sequence is proprietary. Sequence: MASLSGLASALESYRGRDRLIRVLGYCCQLVGGVLVEQCPARSEVG