Rabbit Anti-PEX11B Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-31756P

• Product Name:
• Rabbit Anti-PEX11B Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human PEX11B aa 132-177 (internal sequence). NP_003837.1 Sequence: IMNLSRDAYEIRLLMEQESSACSRRLKGSGGGVPGGSETGGLGGPG

• Species Reactivity:
• Mouse, Rat, Human Predicted to work with: Cow, Orangutan

• Isotype:
• IgG

• Application:
• IHC-P, ICC, WB, IP

• Storage Buffer:
• Preservative: 0.1% Sodium azide Constituents: 49% PBS, 50% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid