Rabbit Anti-Pet1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-31739P

• Product Name:
• Rabbit Anti-Pet1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N terminal aa 35-84 (PLSPAVQKGSGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEV A) of Human Pet1 (NP_059991).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Drosophila melanogaster

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid