Cat#:FPA-31534P;Product Name:Rabbit Anti-PDXDC1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human PDXDC1 aa 11-61. Sequence: PTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISRDIPGPLQGSGQDMVS I ;Species Reactivity:Human Predicted to work with: Mouse, Cow;Isotype:IgG;Application:IHC-P, ICC/IF, WB;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;