Rabbit Anti-PDLIM7 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-31495P

• Product Name:
• Rabbit Anti-PDLIM7 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide: Corresponding to a region between the C terminal residues 407 and 457 of human LIM mineralization protein 1: IDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKDRPLCKSHAFSH V

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Chimpanzee, Rhesus monkey, Gorilla, Orangutan

• Isotype:
• IgG

• Application:
• WB, IP

• Storage Buffer:
• Preservative: 0.09% Sodium Azide Constituents: 0.1% BSA, Tris buffered saline

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid