• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-PDLIM7 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-31495P
  • Product Name:
  • Rabbit Anti-PDLIM7 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide: Corresponding to a region between the C terminal residues 407 and 457 of human LIM mineralization protein 1: IDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKDRPLCKSHAFSH V
  • Species Reactivity:
  • Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Isotype:
  • IgG
  • Application:
  • WB, IP
  • Storage Buffer:
  • Preservative: 0.09% Sodium Azide Constituents: 0.1% BSA, Tris buffered saline
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-PDLIM7 Polyclonal Antibody-FPA-31494P
  • Online Inquiry

    refresh