Rabbit Anti-PCDH11X Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-31112P

• Product Name:
• Rabbit Anti-PCDH11X Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal aa 446-495 ( LNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADS ) of Mouse PCDH11X (NP_001074854).

• Species Reactivity:
• Mouse Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Drosophila melanogaster, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 2% Sucrose, 97% PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid