Rabbit Anti-PBLD Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-31039P

• Product Name:
• Rabbit Anti-PBLD Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide, corresponding to N a region within terminal aa 1-50 (KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFI R) of Human PBLD (NP_001028255).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid