Rabbit Anti-Ovalbumin Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-30275P

• Product Name:
• Rabbit Anti-Ovalbumin Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Full length native protein (purified) corresponding to Chicken Ovalbumin aa 2-386. Highly purified Ovalbumin from chicken egg. Sequence: GSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTR TQINKVVRFDKLPGFGDSIEAQCGTSVNVHSSLRDILNQITKPNDVYSFS LASRLYAEERYPILPE

• Species Reactivity:
• Chicken Predicted to work with: Turkey, Quail

• Isotype:
• IgG

• Application:
• ELISA, WB

• Storage Buffer:
• Preservative: 0.09% Sodium azide

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid