• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Ovalbumin Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-30275P
  • Product Name:
  • Rabbit Anti-Ovalbumin Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Full length native protein (purified) corresponding to Chicken Ovalbumin aa 2-386. Highly purified Ovalbumin from chicken egg. Sequence: GSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTR TQINKVVRFDKLPGFGDSIEAQCGTSVNVHSSLRDILNQITKPNDVYSFS LASRLYAEERYPILPE
  • Species Reactivity:
  • Chicken Predicted to work with: Turkey, Quail
  • Isotype:
  • IgG
  • Application:
  • ELISA, WB
  • Storage Buffer:
  • Preservative: 0.09% Sodium azide
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-Ovalbumin Polyclonal Antibody-FPA-30274P
  • Online Inquiry

    refresh