Cat#:FPA-30067P;Product Name:Rabbit Anti-OR8K5 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human OR8K5 aa 258-307 (C terminal). The exact sequence is proprietary. Sequence: MYMQPNSTHFFDTDKMASVFYTLVIPMLNPLIYSLRNEEVKNAFYKLFEN ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 2% Sucrose, 98% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human OR8K5 aa 258-307 (C terminal). The exact sequence is proprietary. Sequence: MYMQPNSTHFFDTDKMASVFYTLVIPMLNPLIYSLRNEEVKNAFYKLFEN
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
Isotype:
IgG
Application:
WB
Storage Buffer:
Constituents: 2% Sucrose, 98% PBS
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.