Cat#:FPA-30008P;Product Name:Rabbit Anti-OR6C68 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within N-terminal aa 1-50 (MQKSVMRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTII A) of Human OR6C68 (NP_001005519). ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig;Isotype:IgG;Application:WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide corresponding to a region within N-terminal aa 1-50 (MQKSVMRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTII A) of Human OR6C68 (NP_001005519).
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
Isotype:
IgG
Application:
WB
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.