Rabbit Anti-OR6C1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-30001P

• Product Name:
• Rabbit Anti-OR6C1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human OR6C1 aa 227-276 (C terminal). (NP_001005182) Sequence: PSTSQRTKAFSTCSSHMVVVSISYGSCIFMYIKPSAKDRVSLSKGVAILN

• Species Reactivity:
• Human Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 98% PBS, 2% Sucrose

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid