Rabbit Anti-OR51B2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-29885P

• Product Name:
• Rabbit Anti-OR51B2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human OR51B2 aa 260-309 (C terminal). The exact sequence is proprietary. NP_149420 Sequence: YRFGKNVPEVVHIIMSYIYFLFPSLMNPVIYSIKTKQIQYGIIRLLSKHR

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 2% Sucrose, 98% PBS

• Storage Procedures:
• Store at 4°C (up to 6 months). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid