Rabbit Anti-OR2A1 + 2A42 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-29743P

• Product Name:
• Rabbit Anti-OR2A1 + 2A42 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human OR2A1 + 2A42 aa 251-300 (C terminal). The exact sequence is proprietary. (NP_001005287). Sequence: FGSAIIMYMAPKSRHPEEQQKVFFLFYSFFNPTLNPLIYSLRNGEVKGAL

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 2% Sucrose, 98% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid