Rabbit Anti-OAS2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-29434P

• Product Name:
• Rabbit Anti-OAS2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region from N terminal aa 36-85 ( EMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDLK ) of Human OAS2 (NP_002526).

• Species Reactivity:
• Human Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Pig, Chimpanzee

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid