Rabbit Anti-NUDT15 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-29282P

• Product Name:
• Rabbit Anti-NUDT15 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal sequence aa 33-82 ( RKGSFGAGSFQLPGGHLEFGETWEECAQRETWEEAGLHLKNVCFASVVNS ) of Mouse NUDT15 (NP_766115).

• Species Reactivity:
• Mouse Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Saccharomyces cerevisiae

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid