• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-NUDT15 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-29282P
  • Product Name:
  • Rabbit Anti-NUDT15 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to a region within internal sequence aa 33-82 ( RKGSFGAGSFQLPGGHLEFGETWEECAQRETWEEAGLHLKNVCFASVVNS ) of Mouse NUDT15 (NP_766115).
  • Species Reactivity:
  • Mouse Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Saccharomyces cerevisiae
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Constituents: 97% PBS, 2% Sucrose
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-NUDT14 Polyclonal Antibody-FPA-29281P
  • Online Inquiry

    refresh