Rabbit Anti-NT5C1A Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-29168P

• Product Name:
• Rabbit Anti-NT5C1A Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human NT5C1A aa 151-200 (internal sequence). The exact sequence is proprietary. NP_115915.1 Sequence: FCMTGGNSPICYLKAYHTNLYLSADAEKVR EAIDEGIAAATIFSPSRDVV

• Species Reactivity:
• Human Predicted to work with: Mouse

• Isotype:
• IgG

• Application:
• ICC/IF, WB, IHC-P

• Storage Buffer:
• pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol PBS is without Mg2+ and Ca2+.

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid