• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-NT5C1A Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-29168P
  • Product Name:
  • Rabbit Anti-NT5C1A Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide within Human NT5C1A aa 151-200 (internal sequence). The exact sequence is proprietary. NP_115915.1 Sequence: FCMTGGNSPICYLKAYHTNLYLSADAEKVR EAIDEGIAAATIFSPSRDVV
  • Species Reactivity:
  • Human Predicted to work with: Mouse
  • Isotype:
  • IgG
  • Application:
  • ICC/IF, WB, IHC-P
  • Storage Buffer:
  • pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol PBS is without Mg2+ and Ca2+.
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Mouse Anti-NT5C Polyclonal Antibody-FPA-29167P
  • Online Inquiry

    refresh