Rabbit Anti-NSE2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-29118P

• Product Name:
• Rabbit Anti-NSE2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human NSE2 aa 1-50. The exact sequence is proprietary. NP_775956.1 Sequence: MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVE

• Species Reactivity:
• Human Predicted to work with: Chicken, Guinea pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan, Zebra finch

• Isotype:
• IgG

• Application:
• IP

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid