Cat#:FPA-29043P;Product Name:Rabbit Anti-NRBP2 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within internal aa 179-227 ( IQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASELV ) of Human NRBP2 (NP_848659). ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog;Isotype:IgG;Application:WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide corresponding to a region within internal aa 179-227 ( IQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASELV ) of Human NRBP2 (NP_848659).
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog
Isotype:
IgG
Application:
WB
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.