• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-NRARP Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-29034P
  • Product Name:
  • Rabbit Anti-NRARP Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to a region of Human NRARP within internal aa 36-85 ( NMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGW ) (NP_001004354)
  • Species Reactivity:
  • Human Predicted to work with: Mouse, Rat, Chicken, Cow, Dog, Pig, Zebrafish
  • Isotype:
  • IgG
  • Application:
  • ICC/IF, WB
  • Storage Buffer:
  • Preservative: None Constituents: 2% Sucrose, PBS
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Goat Anti-NRAP Polyclonal Antibody-FPA-29033P
  • Online Inquiry

    refresh