Cat#:FPA-29004P;Product Name:Rabbit Anti-NR2E1 / Tailless Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within the N terminal aa 2-51 ( SKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYV ) of Human NR2E1/ Tailless (NP_003260). ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Caenorhabditis elegans, Drosophila melanogaster, Zebrafish;Isotype:IgG;Application:IHC-P, WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide corresponding to a region within the N terminal aa 2-51 ( SKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYV ) of Human NR2E1/ Tailless (NP_003260).
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Caenorhabditis elegans, Drosophila melanogaster, Zebrafish
Isotype:
IgG
Application:
IHC-P, WB
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.