Rabbit Anti-Noto Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-28845P

• Product Name:
• Rabbit Anti-Noto Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N terminal aa 11-60 (VQPGSLRPCPGAVSPVVPRRLARGRLESSFSVEAILARPKTRELAATSL P) of Mouse Noto (NP_001007473).

• Species Reactivity:
• Mouse Predicted to work with: Rat, Rabbit, Guinea pig, Cow, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.

• Clonality:
• Polyclonal

• Form:
• Liquid