Cat#:FPA-28787P;Product Name:Rabbit Anti-NOL6 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within the N terminal aa 35-84 (SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLL R) of Human NOL6 (NP_075068);Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae;Isotype:IgG;Application:WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide corresponding to a region within the N terminal aa 35-84 (SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLL R) of Human NOL6 (NP_075068)
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae
Isotype:
IgG
Application:
WB
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.