Cat#:FPA-28750P;Product Name:Rabbit Anti-NOC3L Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human NOC3L aa 415-464. The exact sequence is proprietary. (NP_071896.8). Sequence: EVRPEMLKTFLCLRIKEVEVKKDTEDINKPKKFMTFKEKRKSLSRMQRKW ;Species Reactivity:Human Predicted to work with: Mouse;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 50% Glycerol, 0.87% Sodium chloride, 49% PBS PBS without Mg2+ and Ca2+.;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human NOC3L aa 415-464. The exact sequence is proprietary. (NP_071896.8). Sequence: EVRPEMLKTFLCLRIKEVEVKKDTEDINKPKKFMTFKEKRKSLSRMQRKW
Species Reactivity:
Human Predicted to work with: Mouse
Isotype:
IgG
Application:
WB, IHC-P
Storage Buffer:
pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 50% Glycerol, 0.87% Sodium chloride, 49% PBS PBS without Mg2+ and Ca2+.
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
USA: 1-862-686-3631
Fax: 1-323-978-5598
Email: