Cat#:FPA-28746P;Product Name:Rabbit Anti-Nobox Polyclonal Antibody;Formulation:Nobox is a homeobox transcription factor that is preferentially expressed in the oocytes and is essential for folliculogenesis and the regulation of oocyte-specific gene expression in the mouse. A likely human homolog has recently been identified.;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human Nobox aa 7-56 (N terminal). The exact sequence is proprietary. Isoform 2 Sequence: LTSPDLEGTWDTRDKDGFKAQEGPPLAVPEFPVCGLYRIYGVCGSFSSFF ;Species Reactivity:Human;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 98% PBS, 2% Sucrose;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Nobox is a homeobox transcription factor that is preferentially expressed in the oocytes and is essential for folliculogenesis and the regulation of oocyte-specific gene expression in the mouse. A likely human homolog has recently been identified.
Host Species:
Rabbit
Immunogen:
Synthetic peptide within Human Nobox aa 7-56 (N terminal). The exact sequence is proprietary. Isoform 2 Sequence: LTSPDLEGTWDTRDKDGFKAQEGPPLAVPEFPVCGLYRIYGVCGSFSSFF
Species Reactivity:
Human
Isotype:
IgG
Application:
WB
Storage Buffer:
Constituents: 98% PBS, 2% Sucrose
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
USA: 1-862-686-3631
Fax: 1-323-978-5598
Email: