Cat#:FPA-28499P;Product Name:Rabbit Anti-NIRF Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within N terminal aa 24 - 73 (TIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLL V) of Mouse NIRF (NP_659122). ;Species Reactivity:Mouse Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 97% PBS, 2% Sucrose;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide corresponding to a region within N terminal aa 24 - 73 (TIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLL V) of Mouse NIRF (NP_659122).
Species Reactivity:
Mouse Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human
Isotype:
IgG
Application:
WB
Storage Buffer:
Constituents: 97% PBS, 2% Sucrose
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.