Rabbit Anti-NFIC Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-28256P

• Product Name:
• Rabbit Anti-NFIC Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide (human). The exact amino acid sequence is considered to be commercially sensitive but was derived from the following sequence: VRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVT SGVFSVTELIQ

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid