Cat#:FPA-28235P;Product Name:Rabbit Anti-NFAT5 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human NFAT5 aa 1171-1220. NP_006590.1 Sequence: QSTSNSEQQAAFQQQAPISHIQTPMLSQEQAQPPQQGLFQPQVALGSLPP ;Species Reactivity:Human Predicted to work with: Mouse;Isotype:IgG;Application:IHC-P, ELISA;Storage Buffer:pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol (PBS is without Mg2+ and Ca2+);Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;