Rabbit Anti-Neuronal calcium-binding protein Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-28143P

• Product Name:
• Rabbit Anti-Neuronal calcium-binding protein Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Neuronal calcium-binding protein aa 321-370. The exact sequence is proprietary. Sequence: DFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRI

• Species Reactivity:
• Human Predicted to work with: Mouse

• Isotype:
• IgG

• Application:
• ICC/IF, WB, IHC-P

• Storage Buffer:
• pH: 7.4 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol without Mg2+, Ca2+

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid