Rabbit Anti-Neurogranin Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-28116P

• Product Name:
• Rabbit Anti-Neurogranin Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N terminal aa 6-55 ( ESACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGECGRKG ) of Rat Neurogranin (NP_077054).

• Species Reactivity:
• Rat Predicted to work with: Mouse, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid