Rabbit Anti-Neurochondrin Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-28076P

• Product Name:
• Rabbit Anti-Neurochondrin Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N-terminal aa 1-50 ( MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS ) of Human Neurochondrin (NP_055099).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid