Rabbit Anti-Neurexin 1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-28055P

• Product Name:
• Rabbit Anti-Neurexin 1 Polyclonal Antibody

• Formulation:
• The neurexin genes use alternate promoters, splice sites and exons to encode potentially hundreds or thousands of mRNA transcripts.

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Neurexin 1 aa 40-90 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: WTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRL Q

• Species Reactivity:
• Rat Predicted to work with: Mouse, Human

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 1% BSA, 50% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal