Rabbit Anti-NDUFB3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-27841P

• Product Name:
• Rabbit Anti-NDUFB3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Fusion protein corresponding to Human NDUFB3 aa 1-98. Full length fusion protein. The identity of the protein fusion partner is GST. Sequence: MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEA WRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IHC-P, WB

• Storage Buffer:
• pH: 7.4 Preservative: 0.05% Sodium azide Constituents: 59% PBS, 40% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid