Rabbit Anti-NDUFAF7 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-27836P

• Product Name:
• Rabbit Anti-NDUFAF7 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human NDUFAF7 aa 383-432 (C terminal). Synthetic peptide, corresponding to a region within C terminal aa 383-432 of Human C2orf56 (NP_653337). Sequence: QQLLQGYDMLMNPKKMGERFNFFALLPHQRLQGGRYQRNARQSKPFASVV

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid