Rabbit Anti-NDUFA7 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-27820P

• Product Name:
• Rabbit Anti-NDUFA7 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human NDUFA7 aa 3-59 (N terminal). Sequence: SATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNN YYCTRDG

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Cow, Chimpanzee, Gorilla

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid