Rabbit Anti-NASP Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-27586P

• Product Name:
• Rabbit Anti-NASP Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human NASP aa 626-675 (internal sequence). The exact sequence is proprietary. Sequence: KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish

• Isotype:
• IgG

• Application:
• IHC-P, WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid