Rabbit Anti-MYBPH Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-27171P

• Product Name:
• Rabbit Anti-MYBPH Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N-terminal aa 107-156, LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP , of Human MYBPH (NP_004988).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Pig

• Isotype:
• IgG

• Application:
• WB, Immunomicroscopy

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid