• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-MURF3 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-47662P
  • Product Name:
  • Rabbit Anti-MURF3 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide within Human MURF3 aa 296-358 (C terminal). The exact sequence is proprietary. Sequence: VELAGRPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEE GSAGPEEERPDGP Database link: Q9BYV2 Run BLAST with Run BLAST with
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • IHC-P
  • Storage Buffer:
  • Immunogen affinity purified
  • Storage Procedures:
  • pH: 7 Preservative: 0.01% Thimerosal (merthiolate) Constituents: 10% Glycerol, 89% Tris glycine
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-Murein Tetrapeptide Carboxypeptidase Polyclonal Antibody-FPA-47661P
  • Online Inquiry

    refresh