Rabbit Anti-Mu Opioid Receptor Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-27010P

• Product Name:
• Rabbit Anti-Mu Opioid Receptor Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Mouse Mu Opioid Receptor aa 251-300 (internal sequence). The exact sequence is proprietary. Isoform 11 Sequence: CYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV

• Species Reactivity:
• Mouse Predicted to work with: Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Pig, Chimpanzee, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid