Cat#:FPA-26863P;Product Name:Rabbit Anti-MTCO3 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide, corresponding to a region within C terminal aa 181-230 (FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSK H) of Human Cytochrome C Oxidase subunit III, NP_536849;Species Reactivity:Human Predicted to work with: Chimpanzee;Isotype:IgG;Application:WB, ELISA;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide, corresponding to a region within C terminal aa 181-230 (FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSK H) of Human Cytochrome C Oxidase subunit III, NP_536849
Species Reactivity:
Human Predicted to work with: Chimpanzee
Isotype:
IgG
Application:
WB, ELISA
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.