Rabbit Anti-MTA3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-26843P

• Product Name:
• Rabbit Anti-MTA3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within the internal sequence aa 400-450 ( CRLCAICWLYWKKYGGLKMPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQG M ) of Human MTA3 (Swiss-Prot entry Q9BTC8, GeneID 57504)

• Species Reactivity:
• Human Predicted to work with: Chimpanzee, Rhesus monkey, Orangutan

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium Azide Constituents: 0.1% BSA, Tris buffered saline

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid