• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-MT1G Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-47644P
  • Product Name:
  • Rabbit Anti-MT1G Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fragment corresponding to Human MT1G aa 1-59. Sequence: MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCI CKGASEKCSC Database link: P13640 Run BLAST with Run BLAST with
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • ELISA
  • Storage Buffer:
  • Caprylic Acid - Ammonium Sulfate precipitation
  • Storage Procedures:
  • pH: 7.4 Preservative: 0.03% Proclin Constituents: 49% PBS, 50% Glycerol
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-MT1E Polyclonal Antibody-FPA-47643P
  • Online Inquiry

    refresh