Cat#:FPA-26665P;Product Name:Rabbit Anti-MRPL53 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human MRPL53 aa 14-85. Sequence: KQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPC VDVLFGDGHRLIMRGAHLTALE ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Cow, Rhesus monkey, Chinese hamster, Common marmoset, Orangutan;Isotype:IgG;Application:IHC-P;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;