• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-MRP8 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-47624P
  • Product Name:
  • Rabbit Anti-MRP8 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant full length protein corresponding to Human MRP8 aa 1-93. Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKG ADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE Database link: P05109 Run BLAST with Run BLAST with
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Caprylic Acid - Ammonium Sulfate precipitation
  • Storage Procedures:
  • pH: 7.4 Preservative: 0.03% Proclin Constituents: 50% Glycerol, 49% PBS
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-MRP6 Polyclonal Antibody-FPA-47623P
  • Online Inquiry

    refresh