Rabbit Anti-MON2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-26358P

• Product Name:
• Rabbit Anti-MON2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human MON2 aa 486-535 (C terminal). Sequence: SVAFHCLLDLVRGITSMIEGELGELETECQTTTEEGSSPTQSTEQQDLQS

• Species Reactivity:
• Human Predicted to work with: Rat, Horse, Cow

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid