Rabbit Anti-MICALCL Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-47600P

• Product Name:
• Rabbit Anti-MICALCL Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• antigen sequence: IRRSLEPLLSNSEGGKKAWAKQESKTLPTQACTRSFSLRKTNSNKDGDQH SPGRNQSSAF SPPDPALRTHSLPNRPSKVFPALRSPPCSKIEDVPTLL, corresponding to aa 277-374 of Human MICALCL (Q6ZW33). Note: at position 305, A was substituted with T. This is a natural variant. Run

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol

• Clonality:
• Polyclonal

• Form:
• Liquid