Rabbit Anti-MGC35062 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-25917P

• Product Name:
• Rabbit Anti-MGC35062 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal aa 144-193 ( ANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENESI ) of Human MGC35062 (NP_940917)

• Species Reactivity:
• Human Predicted to work with: Rabbit, Horse, Guinea pig, Dog, Pig, Saccharomyces cerevisiae

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid