Rabbit Anti-METT10D Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-25809P

• Product Name:
• Rabbit Anti-METT10D Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human METT10D aa 375-425. The exact sequence is proprietary. NP_076991.3 Sequence: ENSWIHLRRKKRERVRQLREVPRAPEDVIQALEEKKPTPKESGNSQELAR G

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cat, Dog, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7-8

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid